DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:76 Identity:33/76 - (43%)
Similarity:48/76 - (63%) Gaps:3/76 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDL-EVSGIYRYINDWGQEVEV 90
            |:|||..|.|....|:|.||:|:.:|...:|.|.|.  :|.|:::: .|.|.|.|.|..|:.||:
  Fly   133 PIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVK--NKGSENEIPSVMGSYSYTNPEGELVEI 195

  Fly    91 RYTADKNGFLP 101
            .||||:|||:|
  Fly   196 MYTADENGFVP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 23/56 (41%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 23/56 (41%)

Return to query results.
Submit another query.