DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr47Ec

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:105 Identity:45/105 - (42%)
Similarity:60/105 - (57%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PVPILKSVTEQLSSGSYLFSFESADGTYR-EELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEV 90
            ||.||||...:...| |..::..|||..| ||..:|  |..|.::.|||.|.|:|||:.||||||
  Fly    28 PVAILKSEIIKTEEG-YTSAYVGADGISRNEEAFLV--DKGTDEEALEVKGSYKYINEDGQEVEV 89

  Fly    91 RYTADKNGFLPHVRYISK-----GEAYKPI-RIEPLALMG 124
            .|||.||||:|:...|:.     .||.|.: ::|.:...|
  Fly    90 FYTAGKNGFVPYGSIINPEITAVAEAAKDLPKVEKVEKAG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 29/56 (52%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 29/56 (52%)

Return to query results.
Submit another query.