DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Lcp3

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_476621.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:101 Identity:27/101 - (26%)
Similarity:43/101 - (42%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDS 65
            ||.:||:   |.|     |...:.|..|.: |.:...:....::......||         |:.|
  Fly     1 MFKILLV---CSL-----AALVAANANVEV-KELVNDVQPDGFVSKLVLDDG---------SASS 47

  Fly    66 KTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLP 101
            .|.|....:.|::.:|:..|..|.|.|.||:||:.|
  Fly    48 ATGDIHGNIDGVFEWISPEGVHVRVSYKADENGYQP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 15/55 (27%)
Lcp3NP_476621.1 Chitin_bind_4 <46..81 CDD:459790 12/34 (35%)

Return to query results.
Submit another query.