DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Lcp1

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_476619.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:118 Identity:27/118 - (22%)
Similarity:51/118 - (43%) Gaps:30/118 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVP------------ILKSVTEQLSSGSYLFSFESADGT 53
            ||..::|   |.:|....|     |.|||            :| |.::.:.:..:..|..:::|.
  Fly     1 MFKFVMI---CAVLGLAVA-----NPPVPHSLGRSEDVHADVL-SQSDDVRADGFDSSLHTSNGI 56

  Fly    54 YREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLPHVRYI 106
                     ..:.:.|....:.|.:.:|:..|:.|||:|.|::||:.|...:|
  Fly    57 ---------EQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 12/55 (22%)
Lcp1NP_476619.1 Chitin_bind_4 46..93 CDD:459790 12/55 (22%)

Return to query results.
Submit another query.