DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and LOC3290086

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_556684.2 Gene:LOC3290086 / 3290086 VectorBaseID:AGAMI1_005124 Length:105 Species:Anopheles gambiae


Alignment Length:69 Identity:24/69 - (34%)
Similarity:39/69 - (56%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSSGSYLFSFESADGTYREELGIVSSDSKTSDDD---LEVSGIYRYINDWGQEVEVRYTADKNGF 99
            |..|||.||::..|...|||..::.:.....::|   |.::|.|.:.:..|:...|:||||:|||
Mosquito    34 LVDGSYSFSYDQTDDHKREESAVLKTVKNFDNEDVPALTITGQYEFTDPDGKRYLVKYTADENGF 98

  Fly   100 LPHV 103
            .|.:
Mosquito    99 NPTI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 18/58 (31%)
LOC3290086XP_556684.2 Chitin_bind_4 39..98 CDD:459790 18/58 (31%)

Return to query results.
Submit another query.