DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr12A

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:105 Identity:32/105 - (30%)
Similarity:48/105 - (45%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFALLL----ILTGCQLLWSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELG-- 59
            :||:.|    :::..|:..|.|:        ..:|.....:...|||.:.||..|||.|.|.|  
  Fly     8 LFAIFLLSATLISAQQIKESAPS--------ARLLDRFDNRYPDGSYEYRFELDDGTARYERGYF 64

  Fly    60 IVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGF 99
            :..:|.||    |.|.|.|.|....|:.:.|.|.||:.|:
  Fly    65 VKINDVKT----LMVVGYYAYRMTDGRYITVFYNADQFGY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 22/57 (39%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 22/57 (39%)

Return to query results.
Submit another query.