DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr65Av

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:79 Identity:25/79 - (31%)
Similarity:40/79 - (50%) Gaps:7/79 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRYTA 94
            ||:...:.:.:..|.|.:|::||..|:|...| .::.|..:.|.|.|...::...||...:.|.|
  Fly    33 ILRYDNDNIGTDGYNFGYETSDGVTRQEQAEV-KNAGTDQEALSVRGSVSWVAPDGQTYTLHYIA 96

  Fly    95 DKNGF------LPH 102
            |:|||      |||
  Fly    97 DENGFQPQGDHLPH 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 18/55 (33%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.