DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and Cpr60D

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:46/104 - (44%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDS 65
            :|||.::|          |.|:..::...:|||...|...|:         |.::.|:.:.:...
  Fly     7 IFALFVVL----------ASCSEEDLQAQLLKSENRQNLDGA---------GQFQHEITVSNGIQ 52

  Fly    66 KTSDDDLE-VSGIYRYINDWGQEVEVRYTADKNGFLPHV 103
            ..:..::. :.|.|....:.|:::.|.||||..||.|.|
  Fly    53 VKAQGNVNGIQGEYFLPGEDGKQIRVTYTADATGFHPKV 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 10/56 (18%)
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 9/45 (20%)

Return to query results.
Submit another query.