DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ed and LOC1276676

DIOPT Version :10

Sequence 1:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster
Sequence 2:XP_316046.3 Gene:LOC1276676 / 1276676 VectorBaseID:AGAMI1_011765 Length:147 Species:Anopheles gambiae


Alignment Length:74 Identity:25/74 - (33%)
Similarity:42/74 - (56%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVS-GIYRYINDWGQEVEV 90
            |:.|:.|.:.....|||.|.:|||:|...:|.|.|.:.. :.|.:::|: |.:.|.:..|..|.:
Mosquito    28 PIKIVHSESYHGHDGSYKFGYESANGIAAQEQGFVKNGG-SKDHEVQVAHGYFSYTDPHGHPVSL 91

  Fly    91 RYTADKNGF 99
            .|.||::||
Mosquito    92 SYVADEHGF 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 18/56 (32%)
LOC1276676XP_316046.3 None

Return to query results.
Submit another query.