DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr65Au

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_652661.1 Gene:Cpr65Au / 59158 FlyBaseID:FBgn0042119 Length:106 Species:Drosophila melanogaster


Alignment Length:96 Identity:33/96 - (34%)
Similarity:50/96 - (52%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAVMVACG--QALPVDPEREPVAI-LKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDEE-- 69
            |...:|.|  .|.|...:.:...| |:||  .|.:.|:.||..::||||.|.. .|..|..||  
  Fly     8 LVAFLAIGICLAFPAGEDAQAETIKLESE--NTGDKYSFAYETSNGISRTETG-EVKPGAGEEDG 69

  Fly    70 ALEVKGSYKYINEDGQEVEVFYTAGKNGFVP 100
            :|.|:||..:...||::.|:.:||.:.|:.|
  Fly    70 SLSVQGSTSWSAPDGKKYEISFTADETGYHP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 21/56 (38%)
Cpr65AuNP_652661.1 Chitin_bind_4 42..98 CDD:459790 21/56 (38%)

Return to query results.
Submit another query.