DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Lcp65Ab2

DIOPT Version :9

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:111 Identity:31/111 - (27%)
Similarity:50/111 - (45%) Gaps:26/111 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KILPLFVLAVMVACG---------QALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEE 58
            |.|.:||....:|..         |...|:||:                ::|....:||.|..:|
  Fly     2 KFLIVFVALFAMAVARPNLAEIVRQVSDVEPEK----------------WSSDVETSDGTSIKQE 50

  Fly    59 AFLVDKGTDEEALEVKGSYKYINE-DGQEVEVFYTAGKNGFVPYGS 103
            ..|.:.|||.||..|.||:.:::| .|::..:.|.|.:||:.|.|:
  Fly    51 GVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 19/55 (35%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:306811 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.