DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and CG8927

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:97 Identity:30/97 - (30%)
Similarity:41/97 - (42%) Gaps:33/97 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 REPVAILKSEIIK-----TEEG-YTSAYVGADGISRNEEAFLVDKGTDEEALEVKGSYKYINEDG 84
            |:||    |:.|:     .|:| .|..|...||..:.|   |:  |||   ...||:|.|::.||
  Fly   255 RQPV----SQTIRKWREENEDGSITWGYENDDGSFKEE---LI--GTD---CITKGTYGYVDPDG 307

  Fly    85 QEVEVFYTAG---------------KNGFVPY 101
            .:.|..|..|               :||||.|
  Fly   308 NKREYHYETGIKCDPNNRNNEEELQENGFVNY 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 19/69 (28%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 18/66 (27%)

Return to query results.
Submit another query.