DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:50/118 - (42%) Gaps:17/118 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCKILPLFVLAVMVACGQALPVDPEREPVAILKSEIIK---TEEGYTSAYVGADGISRNEEAFLV 62
            |.|:....:.|:|:|...|..::.:    |::..|.:.   .|..|..|:..::||...|..   
  Fly     1 MFKLSLCLLAALMLANVYADNINKD----AVITREDVNPADAEGNYQYAFETSNGIQAQEAG--- 58

  Fly    63 DKGTDEEALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGSIINPEITAVAEA 115
                  ....:.||..||:.:|..:.:.|.|.:|||.|.|..: |....:.||
  Fly    59 ------NVNGISGSSSYISPEGVPISLTYVADENGFQPQGDHL-PTAPPIPEA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 13/54 (24%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.