DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr67Fb

DIOPT Version :9

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:100 Identity:26/100 - (26%)
Similarity:45/100 - (45%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILPLFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDE 68
            |:.||::|.:.|      .|..:......::| ||.:..|:..|..::||...|...        
  Fly     7 IISLFLVAAIRA------ADESQAETTKYRNE-IKPDGSYSWEYGTSNGIDAQESGV-------- 56

  Fly    69 EALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGS 103
            ..::..||..|...||..:::.|||.:||:.|.|:
  Fly    57 GGVQAAGSVSYAAPDGTPIQLEYTADENGYRPTGA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 14/54 (26%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.