DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr67Fa1

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster


Alignment Length:108 Identity:26/108 - (24%)
Similarity:47/108 - (43%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVLAVMVACGQALPVDPEREPVAILK-SEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDEEA 70
            |.|.:.::||........:.....|.| ...|:.|..|...|..::||:..|...    |.:   
  Fly     5 LLVASAILACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGI----GGN--- 62

  Fly    71 LEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGSII--NPEITA 111
             ...|.:.:.:.:|:.|::.|.|.:||:.|.|:::  .|.|.|
  Fly    63 -HANGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 12/54 (22%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:459790 12/54 (22%)

Return to query results.
Submit another query.