DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Lcp65Ag1

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster


Alignment Length:101 Identity:37/101 - (36%)
Similarity:51/101 - (50%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KILPLFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTD 67
            |.|.:||....||...     |..|...|::||.....|.:...:..:||.:......|.|.||:
  Fly     2 KFLIVFVALFAVALAA-----PAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTE 61

  Fly    68 EEALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGS 103
            .||:.|.|||::|.:|||..:|.|.|.||||.|.|:
  Fly    62 NEAISVSGSYRFIADDGQTYQVNYIADKNGFQPQGA 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 21/54 (39%)
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.