DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr49Ae

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster


Alignment Length:134 Identity:43/134 - (32%)
Similarity:68/134 - (50%) Gaps:14/134 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KILPLFVLA-VMVACGQALPVDPEREPVAILKSEI-IKTEEGYTSAYVGADGISRNEEAFLVDKG 65
            |...|.:|| .:::|.||.|...| ||:||:..|. |:.:..|..||..|:|| :.||...:.|.
  Fly     2 KNFALCLLATALMSCCQAAPQKAE-EPIAIISQESNIEPDGSYNYAYETANGI-KAEETGTLKKA 64

  Fly    66 TDEEALEV---KGSYKYINEDGQEVEVFYTA-GKNGFVPYGSII--NPEITAVAEAAKD----LP 120
            |..::.:|   :||..|.:.:|..:.:.|:| .:|||.|.|..:  .|.|....:.|.|    ||
  Fly    65 TSPDSSDVIIARGSVSYTSPEGNLITLNYSADDENGFQPQGDHLPTPPPIPPAIQKALDYLLSLP 129

  Fly   121 KVEK 124
            ..::
  Fly   130 PAKR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 18/58 (31%)
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:459790 18/58 (31%)

Return to query results.
Submit another query.