DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Lcp3

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_476621.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:115 Identity:29/115 - (25%)
Similarity:48/115 - (41%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCKILPLFVLAVMVACGQALPVDPEREPVAILKSEIIK--TEEGYTSAYVGADGISRNEEAFLVD 63
            |.|||.:..||.:||....:.|           .|::.  ..:|:.|..|..||.:        .
  Fly     1 MFKILLVCSLAALVAANANVEV-----------KELVNDVQPDGFVSKLVLDDGSA--------S 46

  Fly    64 KGTDEEALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYGSII--NPEITA 111
            ..|.:....:.|.:::|:.:|..|.|.|.|.:||:.|...::  .|.|.|
  Fly    47 SATGDIHGNIDGVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 13/54 (24%)
Lcp3NP_476621.1 Chitin_bind_4 <46..81 CDD:459790 9/34 (26%)

Return to query results.
Submit another query.