DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and CG15756

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster


Alignment Length:95 Identity:24/95 - (25%)
Similarity:36/95 - (37%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ALPVDPEREPVAILKSEIIKTEEG---------------YTSAYVGADGISRNEEAFLVDKGTDE 68
            |.|..|:.:|..::..:...||..               |...|...:|.:|.|.|:.:..|.| 
  Fly    69 APPPQPQPQPPVVVVQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVGKD- 132

  Fly    69 EALEVKGSYKYINEDGQEVEVFYTAGKNGF 98
            ..|..||.|.....:.:...|||||...|:
  Fly   133 LVLAKKGYYSVPLPNDKYSTVFYTADHRGY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 17/54 (31%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.