DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr60D

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster


Alignment Length:101 Identity:26/101 - (25%)
Similarity:43/101 - (42%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILPLFVLAVMVACGQALPVDPEREPVAILKSEIIKTEEGYTSAYVGADGISRNEEAFLVDKGTDE 68
            |..|||  |:.:|.:           ..|:::::|:|...     ..||..:.:....|..|...
  Fly     7 IFALFV--VLASCSE-----------EDLQAQLLKSENRQ-----NLDGAGQFQHEITVSNGIQV 53

  Fly    69 EAL----EVKGSYKYINEDGQEVEVFYTAGKNGFVP 100
            :|.    .::|.|....|||:::.|.|||...||.|
  Fly    54 KAQGNVNGIQGEYFLPGEDGKQIRVTYTADATGFHP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 14/58 (24%)
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 12/45 (27%)

Return to query results.
Submit another query.