DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ec and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:100 Identity:31/100 - (31%)
Similarity:52/100 - (52%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVLAVMVACGQALPV---DPEREPVAILKSE-IIKTEEGYTSAYVGADGISRNEEAFLVDKGTD 67
            ||:.|::::..||.|.   ....||:.|::.| .:..:..|...|...:||:..||.:|.:.|||
  Fly     6 LFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTD 70

  Fly    68 EEALEVKGSYKYINEDGQEVEVFYTAGKNGFVPYG 102
            ......:||:.|.:.:|..:.:.|.|.:|||.|.|
  Fly    71 NAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:459790 17/54 (31%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.