DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13223 and YDL206W

DIOPT Version :9

Sequence 1:NP_610656.1 Gene:CG13223 / 36190 FlyBaseID:FBgn0033599 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_010075.1 Gene:YDL206W / 851321 SGDID:S000002365 Length:762 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:63/273 - (23%)
Similarity:114/273 - (41%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 FLVKLYLIVKQPIDMLLRILIP----KVDMEAPQYGWSKLLFNIQVVLVPTYIAYIIVRGYSIAG 330
            |...|.|:|..|:.::|.:.||    :.|.:.|    ...|.|||::..|..:..:|...:|   
Yeast   504 FFEFLSLLVTTPVSIILYLSIPSEISQTDHDLP----LSYLQNIQLIASPIILNQLITNNFS--- 561

  Fly   331 LAVYMIALILMIPVATLIFFLTRTDTPPIFFRFTSGVGFMAAVFL-IFCLTTEVNAMFFTMA--- 391
                ...|||.:.:|.|::|.|||    |..:|.|.:.|..|..| :.||:..|:.:..|:.   
Yeast   562 ----FWLLILSLVIAILLYFKTRT----IPNKFNSDIIFTVAFLLSLACLSKAVHIIVVTLTHWI 618

  Fly   392 TILQVSQEFSLATAICWALSSNDLVANLSLAHQGWPRMAMTATFSAPVFASFVFLALPLVVNSFV 456
            .:..:|:.....|...|..|..|||:|::....|...:|:.|.|.:|:......:....::....
Yeast   619 NVFNISETILGLTIFTWGNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVGFDGIMIMLG 683

  Fly   457 NAPGNIFPTEGGFGETVCI----------FLEVGMG----FSMLSVL--TTNFKLRRACGFLLVS 505
            :..|.|.   .|....:.:          .:..|:|    |.:.:||  ..::|:.:.....|::
Yeast   684 DKTGKIV---SGRDSNILMHHIDFKVDKNLINTGVGILIAFLIFTVLIPLNDWKIDKKISIALLT 745

  Fly   506 YYIFFVGVLILLE 518
            .||....:.:.||
Yeast   746 LYIVVTCISVFLE 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13223NP_610656.1 Na_Ca_ex 45..194 CDD:279963
Na_Ca_ex 365..516 CDD:279963 33/170 (19%)
YDL206WNP_010075.1 ECM27 28..>223 CDD:223604
ECM27 <543..757 CDD:223604 49/227 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101277
Panther 1 1.100 - - O PTHR12266
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1775
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.