DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13223 and slc8b1

DIOPT Version :9

Sequence 1:NP_610656.1 Gene:CG13223 / 36190 FlyBaseID:FBgn0033599 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001017082.1 Gene:slc8b1 / 549836 XenbaseID:XB-GENE-957176 Length:238 Species:Xenopus tropicalis


Alignment Length:192 Identity:59/192 - (30%)
Similarity:103/192 - (53%) Gaps:12/192 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SQKCKFVQTTPDCLINMNLFNYLGWHYCKVDVRNSFNSFWSVLGMFLIT---IYVFWMMQITIKN 69
            |.:|.|.:|||||.:.....|||...:|      ||......|.:||.|   :|:|.::.:|.:.
 Frog    51 SLRCNFTRTTPDCSVGDGYINYLDGAFC------SFLPSLFPLAIFLYTLWLLYLFIILAVTAEK 109

  Fly    70 YFCPTLMVIADLLRMNESTAGVTVLAIANGSPDFFTAIA--SRVQTSKHSFLSCMSQAMFLHIFV 132
            :|||.|..|:.:||::.:.||||.||..||:||.|:|:|  |..:|:..:..:.....:|:...|
 Frog   110 FFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFVTTVV 174

  Fly   133 AGLVILTKPFNMRANTYLRDFGFLFLNTVYMDYIHKRPKGISWLAALPSAFIFVGYVVVAIV 194
            ||.:.:.|||...:..:|||..| :::.:::.:.......::...||....:::.||.|.::
 Frog   175 AGGITIVKPFTAASRPFLRDIVF-YISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13223NP_610656.1 Na_Ca_ex 45..194 CDD:279963 45/153 (29%)
Na_Ca_ex 365..516 CDD:279963
slc8b1NP_001017082.1 Na_Ca_ex 94..219 CDD:279963 36/125 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8733
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D257493at33208
OrthoFinder 1 1.000 - - FOG0000933
OrthoInspector 1 1.000 - - otm47675
Panther 1 1.100 - - O PTHR12266
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.