DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13223 and CG12061

DIOPT Version :9

Sequence 1:NP_610656.1 Gene:CG13223 / 36190 FlyBaseID:FBgn0033599 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001104467.2 Gene:CG12061 / 3354990 FlyBaseID:FBgn0040031 Length:441 Species:Drosophila melanogaster


Alignment Length:526 Identity:94/526 - (17%)
Similarity:182/526 - (34%) Gaps:133/526 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HDL---LESQKCKFVQTTPDCLINMNLFNYLGWHYCKVDVRNSFNSFWSVLGMFLITIYVFWMMQ 64
            ||:   ::::.|    |.|..:...||.....|              .:::...|:::|:|.::.
  Fly    26 HDMRYDIDARNC----TLPAIVEFPNLMRQKSW--------------IAIVVSTLVSMYLFVILA 72

  Fly    65 ITIKNYFCPTLMVIADLLRMNESTAGVTVLAIANGSPDFFTAIASRVQTSKHSFL-SCMSQAMFL 128
            |...:|..|.:..:...|||....||.|.||.:..:|:.|........|:....| :.:..::|.
  Fly    73 IVCDDYLVPAMERLCYTLRMTYDVAGATFLAASTSAPELFVNFVGTFVTNGDIGLGTIVGSSVFN 137

  Fly   129 HIFVAGLV-ILTKPFNMRANTYLRDFGFLFLNTVYMDYIHKRPKGISWLAALPSAFIFVGYVVVA 192
            .:.:||:. |.|:|..:......||..:..:....:.|: .....:.|..|.....:::.||:..
  Fly   138 ILVIAGVCGIFTQPTKLDWWPVTRDTAWYLIAIASLTYV-LWDSLVMWYEAFALLLLYISYVIQL 201

  Fly   193 IVDQHLLIARIQKMEQRQLNVAEALQLEELKPQKEMPLKRQEIDRPSIGHGSRNKRIFRQFWNTV 257
            ..|:     |||.:.:.:...:|.|. |:...::|.|||           |.|:           
  Fly   202 SFDR-----RIQNLVRHEHAESELLD-EDPMTREEEPLK-----------GFRD----------- 238

  Fly   258 AEFDKDRFHRGTFLVKLYLIVKQPIDMLLRILIPKVDMEAPQYGWSKLLFNIQVVLVPTYIAYII 322
                             ::..|           ||.:....|:.|..:.:..:::|..|      
  Fly   239 -----------------HVCAK-----------PKTEYNFYQWTWWAIKYPAELMLACT------ 269

  Fly   323 VRGYSIAGLAVYMIALILMIPVATLIFFLTRTDTPPIFFRFTSGVGFMAAVFLIFCLTTEVNAMF 387
                               :|.|..||||:                 |.:..|...|.:.:...|
  Fly   270 -------------------VPSARSIFFLS-----------------MISAILWISLISYLLTWF 298

  Fly   388 FT-MATILQVSQEFSLATAICWALSSNDLVANLSLAHQGWPRMAMTATFSAPVFASFVFLALPLV 451
            .| :...|.:.......|.:....|..::.::..::.:|:..||:.....:..|...|.|.||.:
  Fly   299 LTILGYNLNIPDAIMGLTVLAAGTSVPEVASSYIVSKKGYGSMAICNAIGSNTFDILVCLGLPWL 363

  Fly   452 VNSFVNAPGNIFPTEGGFGET----VCIFLEVGMGFSMLSVLTTNFKLRRACGFLLVSYYIFFVG 512
            :...      |:..:.....|    ....|.|......|.:|...|.:.:..|:|.:.:|..|:.
  Fly   364 LKIL------IYQQKIDIDSTALTITTAMLVVTAAVLYLGLLARRFVMGKTVGYLSIIFYALFLI 422

  Fly   513 VLILLE 518
            :...||
  Fly   423 IACTLE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13223NP_610656.1 Na_Ca_ex 45..194 CDD:279963 31/150 (21%)
Na_Ca_ex 365..516 CDD:279963 27/155 (17%)
CG12061NP_001104467.2 TIGR00367 61..422 CDD:273039 84/465 (18%)
Na_Ca_ex 62..199 CDD:279963 30/137 (22%)
Na_Ca_ex 276..424 CDD:279963 31/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.