DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13223 and Slc24a1

DIOPT Version :9

Sequence 1:NP_610656.1 Gene:CG13223 / 36190 FlyBaseID:FBgn0033599 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_659062.1 Gene:Slc24a1 / 214111 MGIID:2384871 Length:1130 Species:Mus musculus


Alignment Length:230 Identity:57/230 - (24%)
Similarity:100/230 - (43%) Gaps:31/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WSVLGMFLITIYVFWMMQITIKNYFCPTLMVIADLLRMNESTAGVTVLAIANGSPDFFTA-IASR 110
            |.||.:|.: :|||..:.|....||.|.|.||...|:::|..||.|.:|....:|:.||: |...
Mouse   421 WVVLHIFGM-MYVFVALAIVCDEYFVPALGVITHKLQISEDVAGATFMAAGGSAPELFTSLIGVF 484

  Fly   111 VQTSKHSFLSCMSQAMFLHIFVAGLVIL--TKPFNMRANTYLRDFGFLFLN-----TVYMDYIHK 168
            :..|.....:.:..|:|..:||.|...|  .:..|:......||..|..|:     ..::|..  
Mouse   485 ISHSNVGIGTIVGSAVFNILFVIGTCALFSREILNLTWWPLFRDVSFYILDLSMLIVFFLDSF-- 547

  Fly   169 RPKGISWLAALPSAFIFVGYVVVAIVDQHLLIARIQKMEQRQLNVAEALQLEEL-KPQKEMPLKR 232
                |:|..:|.....:..||.....::.:.:...:::.:|.  ||:.:.|.:| ||.::...:.
Mouse   548 ----IAWWESLLLLLAYALYVFTMKWNKQIELWVKEQLSRRP--VAKVMALGDLSKPSEDAVEEN 606

  Fly   233 QEIDR-----PSI-----GHGSRNKRIFRQFWNTV 257
            ::.|.     ||:     ...|.:..|.|   ||:
Mouse   607 EQQDSKKLKLPSVLTRGSSSASLHNSIIR---NTI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13223NP_610656.1 Na_Ca_ex 45..194 CDD:279963 42/154 (27%)
Na_Ca_ex 365..516 CDD:279963
Slc24a1NP_659062.1 2A1904 1..1130 CDD:273344 57/230 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.