powered by:
Protein Alignment Cpr47Eb and Cpr78Ca
DIOPT Version :9
Sequence 1: | NP_610655.1 |
Gene: | Cpr47Eb / 36189 |
FlyBaseID: | FBgn0033598 |
Length: | 214 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649298.2 |
Gene: | Cpr78Ca / 40352 |
FlyBaseID: | FBgn0037067 |
Length: | 127 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 34/72 - (47%) |
Gaps: | 9/72 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 NKNPDGSFHFSYEGGDQSVRQEQGV-IENAGTEDEALEVSGMYSYIDADGNTVEVHYTAGKNGFV 104
|..||...|:|:| .:...|: .:.||.|:.|: |:..::..:|..|...|.|..||:.
Fly 37 NTPPDPFGHYSFE-----FQTTNGITTKGAGNENGAV---GVVQFVSPEGIPVTFSYVADANGYQ 93
Fly 105 PIGTIIP 111
|.|..||
Fly 94 PTGDHIP 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.