Sequence 1: | NP_610655.1 | Gene: | Cpr47Eb / 36189 | FlyBaseID: | FBgn0033598 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097627.1 | Gene: | Cpr73D / 39897 | FlyBaseID: | FBgn0036680 | Length: | 597 | Species: | Drosophila melanogaster |
Alignment Length: | 220 | Identity: | 46/220 - (20%) |
---|---|---|---|
Similarity: | 71/220 - (32%) | Gaps: | 78/220 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 GSLAASIGQVDSTT----------------EKREIV--PLLRFETNKNP------DGSFHFSYEG 54
Fly 55 GDQSVRQEQGVIENAGTEDEALEVSGMYSYIDADGNTVEVHYTAGKNGFVPIGTIIPKEITELAK 119
Fly 120 SAALLP-------------------KVSEDEQKYRKARSQE-----------LDNKEV------- 147
Fly 148 --------AVEKEAAPVEKEEPVVA 164 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr47Eb | NP_610655.1 | Chitin_bind_4 | 48..103 | CDD:278791 | 17/54 (31%) |
Cpr73D | NP_001097627.1 | Chitin_bind_4 | 127..174 | CDD:278791 | 17/55 (31%) |
Chitin_bind_4 | <223..257 | CDD:278791 | 7/33 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10380 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |