DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eb and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_610655.1 Gene:Cpr47Eb / 36189 FlyBaseID:FBgn0033598 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:112 Identity:34/112 - (30%)
Similarity:51/112 - (45%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKIAICL-LALVGGSLAASIGQVDSTTEKREIVPLLRFETNKNPDGSFHFSYEGGDQSVRQEQG 64
            |.|.|:.: |.||....||...|.::|..:.||          .||||:.:.|...:....||.|
  Fly     1 MIKTALIISLFLVAAIRAADESQAETTKYRNEI----------KPDGSYSWEYGTSNGIDAQESG 55

  Fly    65 VIENAGTEDEALEVSGMYSYIDADGNTVEVHYTAGKNGFVPIGTIIP 111
            |        ..::.:|..||...||..:::.|||.:||:.|.|..:|
  Fly    56 V--------GGVQAAGSVSYAAPDGTPIQLEYTADENGYRPTGAHLP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EbNP_610655.1 Chitin_bind_4 48..103 CDD:459790 14/54 (26%)
rne <103..211 CDD:236766 3/9 (33%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.