DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eb and Cpr11B

DIOPT Version :9

Sequence 1:NP_610655.1 Gene:Cpr47Eb / 36189 FlyBaseID:FBgn0033598 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:85 Identity:28/85 - (32%)
Similarity:45/85 - (52%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VPLLRFETNKNPDGSFHFSYEGGDQSVRQEQGVIENAGTEDEALEVSGMYSYIDADGNTVEVHYT 97
            :|::|.:.|.:.:|:::|.::.|:...|.|.|.. ..|....:|.|.|.|||...||....|:||
  Fly    70 IPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEF-RGGWPHGSLGVQGSYSYTGDDGKQYTVNYT 133

  Fly    98 AGKNGF------VPIGTIIP 111
            |.||||      :|:...:|
  Fly   134 ADKNGFHAEGAHLPVSPSVP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EbNP_610655.1 Chitin_bind_4 48..103 CDD:278791 20/54 (37%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.