DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:99 Identity:27/99 - (27%)
Similarity:45/99 - (45%) Gaps:11/99 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTIT 103
            |..|::|...:.:|...|:::|...:.:..|..|.::    :.:..|::|.||....||...|:.
  Fly    45 AQKVVVKAAEEYDPHPQYRFSYGVDDKLTGDNKGQVE----ERDGDVVRGEYSLIDADGYKRTVQ 105

  Fly   104 YIADE-NGYRAEGAHIP------TPPPVRAAAAP 130
            |.||. ||:.|.....|      ..|.|:..|||
  Fly   106 YTADPINGFNAVVNREPLVKAVAVAPVVKTVAAP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 15/55 (27%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.