DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Edg78E

DIOPT Version :9

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:81 Identity:37/81 - (45%)
Similarity:48/81 - (59%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 QNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENG 110
            ||...:.:|:|||.|||||||:..|||         .|...:|:.:|..|:|...::||.|||.|
  Fly    29 QNDATDAEGNYQYAYETSNGIQIQEAG---------NANGARGAVAYVSPEGEHISLTYTADEEG 84

  Fly   111 YRAEGAHIPTPPPVRA 126
            |...|.|:||||||.|
  Fly    85 YHPVGDHLPTPPPVPA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 23/54 (43%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.