DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Cpr78Ca

DIOPT Version :9

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:96 Identity:30/96 - (31%)
Similarity:43/96 - (44%) Gaps:23/96 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIAD 107
            |..:|...:|.|.|.:.::|:|||....||   |....:      |...:..|:|:..|.:|:||
  Fly    33 IYYRNTPPDPFGHYSFEFQTTNGITTKGAG---NENGAV------GVVQFVSPEGIPVTFSYVAD 88

  Fly   108 ENGYRAEGAHIP--------------TPPPV 124
            .|||:..|.|||              |.|||
  Fly    89 ANGYQPTGDHIPAIPLHVIRQLEYIRTHPPV 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 16/54 (30%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.