DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Cpr65Aw

DIOPT Version :9

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:109 Identity:41/109 - (37%)
Similarity:64/109 - (58%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLALCCLSFIQAQPQRGLPPPRGNSFDANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLK 75
            |:..|..:||....         .|:.|...::...|.:::.|| |.:::|||:||..:|...||
  Fly     6 LLFGLILVSFCACS---------SNATDTAQILRYDNENMDSDG-YAFSFETSDGISREERATLK 60

  Fly    76 NPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIP 119
            |||:..||..:|||..:.||||:.|.:.|:|||||::|:|.|:|
  Fly    61 NPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 27/54 (50%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439168
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.