DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Lcp65Ag1

DIOPT Version :10

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_477273.1 Gene:Lcp65Ag1 / 38703 FlyBaseID:FBgn0020638 Length:105 Species:Drosophila melanogaster


Alignment Length:80 Identity:32/80 - (40%)
Similarity:52/80 - (65%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIAD 107
            |::...|:.|: |::|::|||:|..|...|.|.:.|::.||..:.|||.:...||..|.:.||||
  Fly    25 IVRSESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIAD 88

  Fly   108 ENGYRAEGAHIPTPP 122
            :||::.:|||:|..|
  Fly    89 KNGFQPQGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 22/54 (41%)
Lcp65Ag1NP_477273.1 Chitin_bind_4 37..92 CDD:459790 22/54 (41%)

Return to query results.
Submit another query.