powered by:
Protein Alignment Cpr47Ea and CG1136
DIOPT Version :9
Sequence 1: | NP_610654.1 |
Gene: | Cpr47Ea / 36188 |
FlyBaseID: | FBgn0033597 |
Length: | 135 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647853.1 |
Gene: | CG1136 / 38479 |
FlyBaseID: | FBgn0035490 |
Length: | 458 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 15/62 - (24%) |
Similarity: | 28/62 - (45%) |
Gaps: | 8/62 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 QYNYETSNG------IRADEAGYLKNPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYR 112
||:.:|..| .:.|...:.|. .:::...:.|:.::....|.:....||||:.|||
Fly 25 QYHIQTDEGPERYFRFQTDSGQFRKE--KRLQDGTVIGTEAWIDAAGYLRQKDYIADKQGYR 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cpr47Ea | NP_610654.1 |
Chitin_bind_4 |
56..111 |
CDD:278791 |
12/59 (20%) |
CG1136 | NP_647853.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.