DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Cpr47Ef

DIOPT Version :9

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:105 Identity:47/105 - (44%)
Similarity:62/105 - (59%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQRGLPPPRGNSFDANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQVMQGS 89
            |..|.||..|....    ||....:.:.||:|:::|||.|||:|.|.|.:||.||:.|...:.||
  Fly   122 PSGGAPPTSGPPIP----ILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGS 182

  Fly    90 YSYTGPDGVVYTITYIADENGYRAEGAHIPTPPPVRAAAA 129
            ||||.|:|.:..|.|.|||||:...|..:|||||:..|.|
  Fly   183 YSYTNPEGELVEIMYTADENGFVPSGNALPTPPPIPEAIA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 29/54 (54%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.