DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:82 Identity:21/82 - (25%)
Similarity:38/82 - (46%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPRGNSFDANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQIEAQV-MQGSYSYTG 94
            |....|.:....|||...:....|||.:::|:::|...:|.|.:.:.....:..: :.|.|.|..
  Fly    18 PAECTSINVPVPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYIN 82

  Fly    95 PDGVVYTITYIADENGY 111
            ..|....:.|.||:||:
  Fly    83 DWGQEVEVRYTADKNGF 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 13/55 (24%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 13/55 (24%)

Return to query results.
Submit another query.