DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:117 Identity:59/117 - (50%)
Similarity:78/117 - (66%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLALCCLSFIQAQPQRGLPPPRGNSFDANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLK 75
            |.:|...||..||:||     .||.:......|::|..::|.||||:|.|||.|||.|:|.||||
  Fly     6 LFIAALLLSLAQARPQ-----VRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLK 65

  Fly    76 NPGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTPPPVRAA 127
            |||:....||.|||:|||.|:|:...|||:|||||::.:|.|:|||||:..|
  Fly    66 NPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 34/54 (63%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 34/54 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439174
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.