DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Ea and LOC1273355

DIOPT Version :10

Sequence 1:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster
Sequence 2:XP_312322.1 Gene:LOC1273355 / 1273355 VectorBaseID:AGAMI1_001204 Length:137 Species:Anopheles gambiae


Alignment Length:54 Identity:18/54 - (33%)
Similarity:24/54 - (44%) Gaps:8/54 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NEKEAADPQGVKSLWRPEYGAYMIEGTPGKPYGGLLAHFNVVEANMRYRRMEVA 132
            |.:..|...|..|.||...|.       |.|| ||.|...:::|....|||::|
Mosquito   760 NGENGAAGGGASSGWRLPPGL-------GSPY-GLSATTGLLDATPVNRRMQLA 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:459790 9/31 (29%)
LOC1273355XP_312322.1 Chitin_bind_4 55..114 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.