DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or19a

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:395 Identity:83/395 - (21%)
Similarity:152/395 - (38%) Gaps:83/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 REMWKRPYRAMNV-----FSIAAIFPFILAAVLHNWKNVLLLADAMVALLITILGLFKFSMILYL 83
            |..|.|.|.|.::     |.|.....|.:..:..|  ::....:::...:...|.:.|...:..:
  Fly    30 RTFWGRHYTAYSMVWNVTFHICIWVSFSVNLLQSN--SLETFCESLCVTMPHTLYMLKLINVRRM 92

  Fly    84 RRD------FKRLIDKFRLLMSNEAE---QGEEYAEILNAANKQDQRMCTLFRTCFLLAWALNSV 139
            |..      ..||:|| ||...:|.:   .|.|.||.             :|||.|      ..:
  Fly    93 RGQMISSHWLLRLLDK-RLGCDDERQIIMAGIERAEF-------------IFRTIF------RGL 137

  Fly   140 LPLVRMGLSYWLAGHAEPELPFPCLFPWN-------------IH---IIRNYVLSFIWSAFASTG 188
            ...|.:|:.| ::..:||.|.:|...|||             :|   ::.|..|....|::..|.
  Fly   138 ACTVVLGIIY-ISASSEPTLMYPTWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTY 201

  Fly   189 VVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVRFKG---GSLKESQATLNKVFALYQTSLDMCNDL 250
            ::|  ||:.|...:...:...:.  |....||.:.   |.:.:.|..| ::|...:.||.|    
  Fly   202 LIL--VSVHTKALALRVSKLGYG--APLPAVRMQAILVGYIHDHQIIL-RLFKSLERSLSM---- 257

  Fly   251 NQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYASFIATIII---QAYIYCYCGENLKTE 312
             .|:     .|||.::...|.:.|.  :.|.....:.:.:.:..::|   :..:.||..|....|
  Fly   258 -TCF-----LQFFSTACAQCTICYF--LLFGNVGIMRFMNMLFLLVILTTETLLLCYTAELPCKE 314

  Fly   313 SASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAH-RGFRITGYFFEANMEAFSSIVRTAMS 376
            ..|...|:|...|...      |.:..|.||:.:.|.. ....::|.....:|:.|:.:::.|.:
  Fly   315 GESLLTAVYSCNWLSQ------SVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYT 373

  Fly   377 YITML 381
            .:|:|
  Fly   374 MLTLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 71/350 (20%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 71/350 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.