DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or98a

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:384 Identity:77/384 - (20%)
Similarity:140/384 - (36%) Gaps:75/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IFPFILAAVLHNWKNVLLLADAMVAL-----------LITILGLF------KFSMI---LYLRRD 86
            |..:|.:.::..|..|.|....:::.           |:|::.||      .|.::   ||:...
  Fly    41 IIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYISGF 105

  Fly    87 F--KRLIDKFRLLMSNEAEQGEEYAEIL--NAANKQDQRMCTLFRTCFLLAWALNSVLPLVRMGL 147
            :  |:|:.:.....:...|:.|.:..::  |.|....|.:.|.:.....|:.||:..|       
  Fly   106 YKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKAYLIYQFIYTAYTISTFLSAALSGKL------- 163

  Fly   148 SYWLAGHAEPELPFPCLFPWNIH----IIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLC 208
                              ||.|:    ..|....||..:|...|.::|.||: .|:.......|.
  Fly   164 ------------------PWRIYNPFVDFRESRSSFWKAALNETALMLFAVT-QTLMSDIYPLLY 209

  Fly   209 AFFKIAQYKVVRFK--------GGSLKESQATLNKVFALYQTSLDMCNDLNQCYQPIICAQFFIS 265
            ........|::|.:        |.|..|::..|.|....:...:|....:.......|..||.:.
  Fly   210 GLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLLI 274

  Fly   266 S--LQLCMLGYLFSITFAQT-EGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHE 327
            .  |.|.|:..||   ||.. .|:...::|..:::|.:.:|:..:.||.:......||:.|.|..
  Fly   275 GICLGLSMINLLF---FADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWIN 336

  Fly   328 SLGAGGASTSICRSLLISMMRAHRGFRIT-GYFFEANMEAFSSIVRTAMSYITMLRSFS 385
            |      |.|...||...:..|.:....| |..|..:..:...:.:.|.|.:|.:...:
  Fly   337 S------SRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 71/358 (20%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 69/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.