DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or94b

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:369 Identity:84/369 - (22%)
Similarity:153/369 - (41%) Gaps:51/369 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IFPFIL------AAVLHNWKNVLLLAD-----AMVALLITILGLF-KFSMILYLRRDFKRLIDK- 93
            |:||:|      ..:...|...:..:|     .::.:.||.|.|. |...|.|.|.:...||.: 
  Fly    40 IYPFVLHLPLTFTYIALMWYEAITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHEL 104

  Fly    94 -----FRLLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTCFLLAWALNSVLPLVRMG-LSYWLA 152
                 |.|..|.|.:..:           |:||.   |:..|.  |.:...|.:..|| :|.:. 
  Fly   105 QHDPAFNLRNSEEIKFWQ-----------QNQRN---FKRIFY--WYIWGSLFVAVMGYISVFF- 152

  Fly   153 GHAEPELPFPCLFPWNIHIIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYK 217
             ..:.||||....|:.......|..::.::..|.|...|..:.|||:.|.|..::.:.|::...:
  Fly   153 -QEDYELPFGYYVPFEWRTRERYFYAWGYNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMR 216

  Fly   218 VVRFKGGSLKESQATLNKVFALYQTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGY-LFSITFA 281
            :...|..:.::::..|.::|.|:.....:..:......|.:.:|...|:..:|...| |..:.|.
  Fly   217 LEALKNAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFK 281

  Fly   282 QTEGVYYAS--FIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHE-SLGAGGASTSICRSLL 343
            |..|::..:  |:|.:|:|.::.||.|..|...:.:...:::.:.|.| |:|.        |.||
  Fly   282 QRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGT--------RKLL 338

  Fly   344 ISMMR-AHRGFRI-TGYFFEANMEAFSSIVRTAMSYITMLRSFS 385
            ...|. ..|..:: .|.|||..:..|...:..|.|:..:|...|
  Fly   339 NCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLKIS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 75/337 (22%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 75/331 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.