DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or67b

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:396 Identity:77/396 - (19%)
Similarity:141/396 - (35%) Gaps:139/396 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QVQKSTIALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLHNWKNVLLLADAMVALLIT 70
            :|.|| :.|...||          |.:...:.|::.|       :|:||    ::.|..|.....
  Fly   115 EVLKS-LGLFQLDL----------PRKKELLSSVSLI-------LLNNW----MIIDRQVMFFFK 157

  Fly    71 ILGLFKFSMILY--LRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTCFLLA 133
            |:.:    .:||  :|..|:.:.|.:                      .:|:..|.:..|     
  Fly   158 IVCM----PVLYYCVRPYFQYIFDCY----------------------IKDKDTCEMTLT----- 191

  Fly   134 WALNSVLPLVRMGLSYWLAGHAEPELPFPCLFPWNIHIIRNYVLSF--IWSAFASTGVVLPAVSL 196
              ..:::|.:::|           ...||.      ::||.::|..  :|..||..|.    .||
  Fly   192 --YPAIVPYLQLG-----------NYEFPS------YVIRFFLLQSGPLWCFFAVFGF----NSL 233

  Fly   197 DTIFCSFTSNLCAFFKIAQYKVVRF------------KGGSLKESQATLNKVFALYQTSLDMCND 249
            ..:...:.|.|        .||:||            |...:|..|..: ::||...:.   .|.
  Fly   234 FVVLTRYESGL--------IKVLRFLVQNSTSDILVPKDQRVKYLQCCV-RLFARISSH---HNQ 286

  Fly   250 LNQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYAS---FIATIIIQAYIYCYCGENLKT 311
            :...::.||..|..:||:.:|||.|..| |..:...|:...   :..||.::..:|....:.:::
  Fly   287 IENLFKYIILVQCSVSSILICMLLYKIS-TVLEVGWVWMGMIMVYFVTIALEITLYNVSAQKVES 350

  Fly   312 ESASF--EWAIYDSPWHES--------------------LGAGGASTSICRSLLISMMRAHRGFR 354
            :|...  :|  |:..|:..                    |..|| .||:....|:.:      ||
  Fly   351 QSELLFHDW--YNCSWYNESREFKFMIKMMLLFSRRTFVLSVGG-FTSLSHKFLVQV------FR 406

  Fly   355 ITGYFF 360
            ::..||
  Fly   407 LSANFF 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 65/346 (19%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 52/253 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.