DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or59b

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:398 Identity:80/398 - (20%)
Similarity:146/398 - (36%) Gaps:105/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AMNVFSIAAIFPFILAAVLHNWKNVL---LLADAMVALLITILGLFKFSMILYL----RRDFKRL 90
            |..||.:...|   :.:.:..:||..   .|....|.  |.:.|....|.|.||    .|..:.|
  Fly    55 AFGVFYLPVGF---IISYVQEFKNFTPGEFLTSLQVC--INVYGASVKSTITYLFLWRLRKTEIL 114

  Fly    91 IDKFRLLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTC---FLLAWALNSVLPLVRMG------ 146
            :|.....::|::::               :|:..:...|   ||       :...:..|      
  Fly   115 LDSLDKRLANDSDR---------------ERIHNMVARCNYAFL-------IYSFIYCGYAGSTF 157

  Fly   147 LSYWLAGHAEPELPFPCLFPWNIH------------IIRNYVLSFIWSAFASTGVVLPAVSLDTI 199
            |||.|:|..          ||:::            :....:..:|..:||    ||.....||.
  Fly   158 LSYALSGRP----------PWSVYNPFIDWRDGMGSLWIQAIFEYITMSFA----VLQDQLSDTY 208

  Fly   200 FCSFTSNLCAFFKIAQYKVVRFKGGSLK---------ESQATLNKVFALYQTSLDMCNDLNQCYQ 255
            ...||    ..|: |..:|::....||:         ..|..:|.|.. ::|.|..|:.:    :
  Fly   209 PLMFT----IMFR-AHMEVLKDHVRSLRMDPERSEADNYQDLVNCVLD-HKTILKCCDMI----R 263

  Fly   256 PIICAQFFISSLQLCMLGYLFSITFAQT-------EGVYYASFIATIIIQAYIYCYCGENLKTES 313
            |:|....|:   |..::|.:..:|....       :||....|:.||::|.:.:||....|..::
  Fly   264 PMISRTIFV---QFALIGSVLGLTLVNVFFFSNFWKGVASLLFVITILLQTFPFCYTCNMLIDDA 325

  Fly   314 ASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRG-FRITGYFFEANMEAFSSIVRTAMSY 377
            ......|:.|.|.:      |......:|::.|....:. ..|.|..|..:|.:..::.:.|.|.
  Fly   326 QDLSNEIFQSNWVD------AEPRYKATLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSI 384

  Fly   378 ITMLRSFS 385
            ||::|..:
  Fly   385 ITIVRQMN 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 70/363 (19%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 69/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.