DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or49a

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:432 Identity:87/432 - (20%)
Similarity:169/432 - (39%) Gaps:99/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSFLQVQKSTIALLGFDLFSENREMWK----RPYRAMNVFSIAAIFPFILAAV----LHNWKNVL 58
            :.|:.:.......||:|||...:..|:    |.|     |.:..|..|..|::    :..|::  
  Fly     8 EDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGY-----FVLCTISNFYEASMVTTRIIEWES-- 65

  Fly    59 LLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLL-MSNEAEQGEEYAEILNAANKQDQRM 122
             ||.:...::..  ||..|.|:....:....:|::.||| :|:..::       |....:|:||.
  Fly    66 -LAGSPSKIMRQ--GLHFFYMLSSQLKFITFMINRKRLLQLSHRLKE-------LYPHKEQNQRK 120

  Fly   123 CTLFRTCFLLAWALNSVL-------------PLVRMGLSYWLAGHAEPELPFPCLFPWNIHI--- 171
            ..:.:  :.|:.:..:||             |||:..:.| |.|..:.:..:..:||..:..   
  Fly   121 YEVNK--YYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMY-LIGFGKADFTYKRIFPTRLTFDSE 182

  Fly   172 -----IRNYVLSFIWSAFASTGVVLPAVSLDT---IFC---------SFTSNLCAFFKIAQYKVV 219
                 :..||:.|.:|.|      :..|||.|   :.|         .:.:|:.|          
  Fly   183 KPLGYVLAYVIDFTYSQF------IVNVSLGTDLWMMCVSSQISMHLGYLANMLA---------- 231

  Fly   220 RFKGGSLKESQAT-------LNKVFALYQTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFS 277
                 |::.|..|       |..:...:|..:.:..|:|..:..::.:..|.:|..||.:.|...
  Fly   232 -----SIRPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTV 291

  Fly   278 ITFAQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSL 342
            :.....||:.|....|::..|.|:....|:.|...|.:...|.::|.|:|      .|....:.:
  Fly   292 VEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYE------GSLRYKKEI 350

  Fly   343 LISMMRAHRGFRIT--GYFFEANMEAFSSIVRTAMSYITMLR 382
            ||.|.:|.|...|:  |... .:::.|..::.....:..::|
  Fly   351 LILMAQAQRPLEISARGVII-ISLDTFKILMTITYRFFAVIR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 72/361 (20%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.