DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or42b

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:248 Identity:59/248 - (23%)
Similarity:103/248 - (41%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LSYWLAGHAEPEL--PFPCLFPWNIHIIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCA 209
            ||..|:|....:|  ||   ..|:...::.:|.|.: .....:|.||.....|:....:|..|.|
  Fly   157 LSSVLSGRPPWQLYNPF---IDWHDGTLKLWVASTL-EYMVMSGAVLQDQLSDSYPLIYTLILRA 217

  Fly   210 FFKIAQYKVVRFKGG---SLKESQATLNKVFALYQTSLDMCNDLNQCYQPIICAQFFISSLQLCM 271
            ...:.:.::.|.:..   |..||...|.|....::..|..|..:....|..|..||.:..|   :
  Fly   218 HLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGL---V 279

  Fly   272 LGY-LFSITFAQT--EGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGG 333
            ||: |.::.|...  .|:....|:.||::|.:.:||....:..:..|...||:.|.|.:      
  Fly   280 LGFTLINVFFFSDIWTGIASFMFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVD------ 338

  Fly   334 ASTSICRSLLISMMRAHRGF-RITGYFFEANMEAFSSIVRTAMSYITMLRSFS 385
            ||.....:||..:....:.. .|.|..|:.:|.:..|:.:.|.|.||:.:..:
  Fly   339 ASRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQMN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 55/236 (23%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 55/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.