DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or42a

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523622.2 Gene:Or42a / 35514 FlyBaseID:FBgn0033041 Length:406 Species:Drosophila melanogaster


Alignment Length:251 Identity:53/251 - (21%)
Similarity:94/251 - (37%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LIDKFRLLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTCFLLAWALNSVLPLVRMGLSYWLAGH 154
            |:|:....:::..|:.:     ::.|.....|:...|...::: :|.|:.|..:.:|        
  Fly   116 LLDEMDRRITDPGERLQ-----IHRAVSLSNRIFFFFMAVYMV-YATNTFLSAIFIG-------- 166

  Fly   155 AEPELPFPCLFP---W---NIHIIRNYVLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKI 213
             .|  |:...:|   |   .:|:.....|.:    ||..|.....|.:|....:|...|.|...|
  Fly   167 -RP--PYQNYYPFLDWRSSTLHLALQAGLEY----FAMAGACFQDVCVDCYPVNFVLVLRAHMSI 224

  Fly   214 AQYKVVRFKGGSLKESQATLNKVFALYQTSLDMCNDLN--QCYQPIICAQFFISSLQLCMLGYLF 276
            ...::.|. |....|||.  .|...|.|...|....|.  .|.:|:|....|:   |..::|.:.
  Fly   225 FAERLRRL-GTYPYESQE--QKYERLVQCIQDHKVILRFVDCLRPVISGTIFV---QFLVVGLVL 283

  Fly   277 SIT------FAQTEGVYYA-SFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPW 325
            ..|      ||.......| ||:|.::::...:|.....|..:......|::.|.|
  Fly   284 GFTLINIVLFANLGSAIAALSFMAAVLLETTPFCILCNYLTEDCYKLADALFQSNW 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 53/251 (21%)
Or42aNP_523622.2 7tm_6 79..384 CDD:251636 53/251 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.