DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or33c

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:368 Identity:70/368 - (19%)
Similarity:131/368 - (35%) Gaps:78/368 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ILAAVLHNWKNVLLLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAE 110
            :|.:....:||:.:....:...|..:..|:....|:    :.:.||::....:::|.|. ..|.:
  Fly    57 LLPSTAEFFKNLTMSLTCVACSLKHVAHLYHLPQIV----EIESLIEQLDTFIASEQEH-RYYRD 116

  Fly   111 ILNAANKQDQRMCTLFRTCFLLAWALNSVLPL----VRMGLSYWLAGHAEPELPFPCLFPWNIH- 170
            .::...::       |..|..:::.:...|.|    |::....|       ||.:|..||:::. 
  Fly   117 HVHCHARR-------FTRCLYISFGMIYALFLFGVFVQVISGNW-------ELLYPAYFPFDLES 167

  Fly   171 ------IIRNY-VLSFIWSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVRFKGGSLKE 228
                  :...| |.|.:...|...|        :..:...|  ||..........:|.......:
  Fly   168 NRFLGAVALGYQVFSMLVEGFQGLG--------NDTYTPLT--LCLLAGHVHLWSIRMGQLGYFD 222

  Fly   229 SQATLNKVFALYQTSLDMCNDLNQCYQPIICAQFF------ISSLQLCMLG-----------YLF 276
            .:..:|     :|..||...      |..:..:|.      ||.:||..||           |:.
  Fly   223 DETVVN-----HQRLLDYIE------QHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYML 276

  Fly   277 SITFAQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRS 341
            .........|||..|...:.:|.:..||....:..|.....:||:.|.|::.      |......
  Fly   277 FFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQ------SRDHRFD 335

  Fly   342 LLI--SMMRAHRGFRI-TGYFFEANMEAFSSIVRTAMSYITML 381
            |||  .:...:||:.| .|...|.|:.||.:.::.|.|...::
  Fly   336 LLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 66/350 (19%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 67/357 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.