DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or9a

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:392 Identity:129/392 - (32%)
Similarity:214/392 - (54%) Gaps:22/392 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSFLQVQKSTIALLGFDLFS---ENREMWKRPYRAMNVFSIAAIF----PFILAAVLHNW-KNVL 58
            |..|:||......:|.||:|   .|...|      :...::..:|    |..|||  |.: ..|.
  Fly    14 DQSLRVQILVYRCMGIDLWSPTMANDRPW------LTFVTMGPLFLFMVPMFLAA--HEYITQVS 70

  Fly    59 LLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQDQRMC 123
            ||:|.:.:...::|.|.||.:..|.|::|..||...|.:::.|.|...:..||:...|:.||.:.
  Fly    71 LLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLS 135

  Fly   124 TLFRTCFLLAWALNSVLPLVRMGLSYWLAGHAEPELPFPCLFPWNIHIIRNYVLSFIWSAFASTG 188
            ..:..||.||....::.|.|.:.||.........|||...::|:::.::..||.:::|:..||..
  Fly   136 LTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYS 200

  Fly   189 VVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVRFKGGSLKESQATLNKVFALYQTSLDMCNDLNQC 253
            .|..|:.:|::...||.|:||.||||:::::.......||....|.:|..|:|..|.:.:.:...
  Fly   201 AVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELEGLVQVLLLHQKGLQIADHIADK 265

  Fly   254 YQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEW 318
            |:|:|..|||:|:||:|.:|:..:..|...:.:|:.:|:.:::|..:||..||||:|:.|..|..
  Fly   266 YRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGN 330

  Fly   319 AIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGYFFEANMEAFSSIVRTAMSYITMLRS 383
            .:|::.|.:      .|....|:|||:.|||.|..::.||||||:|..||:|||:|:|||.||||
  Fly   331 GLYETNWTD------FSPPTKRALLIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMMLRS 389

  Fly   384 FS 385
            |:
  Fly   390 FN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 104/318 (33%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 104/318 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H62715
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26277
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009998
OrthoInspector 1 1.000 - - mtm9636
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.