DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47a and Or69a

DIOPT Version :9

Sequence 1:NP_523689.1 Gene:Or47a / 36187 FlyBaseID:FBgn0026386 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:397 Identity:78/397 - (19%)
Similarity:141/397 - (35%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IALLGFDLFSENREMWKRPYRAMNVFSIAAIFPFILAAVLHNWKNVLLLADAMVALLITILGLFK 76
            |..:.:..|.:.|......|.| .:.|:|::..|.:...|:.||                     
  Fly    54 IGCVMYGYFGDGRTKDPIAYLA-ELASVASMLGFTIVGTLNLWK--------------------- 96

  Fly    77 FSMILYLRRDFKRLIDKFR---LLMSNEAEQGEEYAEILNAANKQDQRMCTLFRTCFLLAWALNS 138
               :|.|:..|:.|:::|.   .|:.:.|.:...|.|    ...:..|...:|.|..::.:....
  Fly    97 ---MLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQE----KYTRHIRNTFIFHTSAVVYYNSLP 154

  Fly   139 VLPLVR------MGLSYWLAGHAEPELPFPCLFPWNIHIIRNYVLSFIWSAFASTGVVLPAVSLD 197
            :|.::|      ..|.|.:..:.        .:||.:.       ..|...||:  |.....|..
  Fly   155 ILLMIREHFSNSQQLGYRIQSNT--------WYPWQVQ-------GSIPGFFAA--VACQIFSCQ 202

  Fly   198 TIFC--SFTSNLCAFFKIAQYKVVRFKGGSLKESQATLN----------KVFALYQTS-LDMCND 249
            |..|  .|...|..||.| |.: :.|.|  |.....|::          |...:|.|. |::.:.
  Fly   203 TNMCVNMFIQFLINFFGI-QLE-IHFDG--LARQLETIDARNPHAKDQLKYLIVYHTKLLNLADR 263

  Fly   250 LNQCYQPIICAQFFISSLQLCMLGYLFSITFAQTEGVYYASFIATIIIQAYIYCYC--GENLKTE 312
            :|:.:.........:|.:..|.|.  ||:|.... |......:..::...|.:..|  |.:|...
  Fly   264 VNRSFNFTFLISLSVSMISNCFLA--FSMTMFDF-GTSLKHLLGLLLFITYNFSMCRSGTHLILT 325

  Fly   313 SASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRITGY-FFEANMEAFSSIVRTAMS 376
            |.....|.:.:.|:|      ......|.|||.||||.:.:....| ....::..:.:.::.:..
  Fly   326 SGKVLPAAFYNNWYE------GDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQ 384

  Fly   377 YITMLRS 383
            ..|.:||
  Fly   385 MFTCVRS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47aNP_523689.1 7tm_6 56..375 CDD:251636 64/343 (19%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 71/367 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.